ETHE1 (NM_014297) Human Mass Spec Standard

CAT#: PH302114

ETHE1 MS Standard C13 and N15-labeled recombinant protein (NP_055112)

Product Images

Coomassie blue staining of purified ETHE1 protein (Cat# TP302114). The protein was produced from HEK293T cells transfected with ETHE1 cDNA clone (Cat# RC202114) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202114
• Predicted MW: 27.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202114 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGL
  RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCV
  TFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERT
  LNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055112
• RefSeq Size: 978
• RefSeq ORF: 762
• Synonyms: HSCO; YF13H12
• Locus ID: 23474
• UniProt ID: O95571, A0A0S2Z5B3
• Cytogenetics: 19q13.31
• Summary: This gene encodes a member of the metallo beta-lactamase family of iron-containing proteins involved in the mitochondrial sulfide oxidation pathway. The encoded protein catalyzes the oxidation of a persulfide substrate to sulfite. Certain mutations in this gene cause ethylmalonic encephalopathy, an infantile metabolic disorder affecting the brain, gastrointestinal tract and peripheral vessels. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]