OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMM1 (NM_002676) Human Mass Spec Standard

Be the first to review this product
SKU
PH302004
PMM1 MS Standard C13 and N15-labeled recombinant protein (NP_002667)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337686 Rabbit Polyclonal Anti-PMM1 Antibody
100 ul
$585.00
LY419180 Transient overexpression lysate of phosphomannomutase 1 (PMM1) (as WB positive control) 100 ug
$436.00

Other products for "PMM1 or NM_002676"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202004
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC202004 protein sequence
Red=Cloning site Green=Tags(s)

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVI
EKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISP
IGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSF
DTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002667
RefSeq Size 1295
RefSeq ORF 786
Synonyms PMM 1; PMMH-22; Sec53
Locus ID 5372
UniProt ID Q92871
Cytogenetics 22q13.2
Summary Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylation and thus the secretion of several glycoproteins as well as for the synthesis of glycosyl-phosphatidyl-inositol (GPI) anchored proteins. provided by RefSeq, Jul 2008
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMM1" proteins (4)
SKU Description Size Price
LC419180 Lyophilized PMM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419180 Transient overexpression lysate of phosphomannomutase 1 (PMM1) (as WB positive control) 100 ug
$436.00
TP302004 Recombinant protein of human phosphomannomutase 1 (PMM1), 20 µg 20 ug
$867.00
TP720222 Recombinant protein of human phosphomannomutase 1 (PMM1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products