PMM1 (NM_002676) Human Mass Spec Standard
CAT#: PH302004
PMM1 MS Standard C13 and N15-labeled recombinant protein (NP_002667)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202004 |
Predicted MW | 29.7 kDa |
Protein Sequence |
>RC202004 protein sequence
Red=Cloning site Green=Tags(s) MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVI EKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISP IGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSF DTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002667 |
RefSeq Size | 1295 |
RefSeq ORF | 786 |
Synonyms | PMM 1; PMMH-22; Sec53 |
Locus ID | 5372 |
UniProt ID | Q92871, A0A024R1U5 |
Cytogenetics | 22q13.2 |
Summary | Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylation and thus the secretion of several glycoproteins as well as for the synthesis of glycosyl-phosphatidyl-inositol (GPI) anchored proteins. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419180 | PMM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419180 | Transient overexpression lysate of phosphomannomutase 1 (PMM1) |
USD 436.00 |
|
TP302004 | Recombinant protein of human phosphomannomutase 1 (PMM1), 20 µg |
USD 867.00 |
|
TP720222 | Recombinant protein of human phosphomannomutase 1 (PMM1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review