POLR2K (NM_005034) Human Mass Spec Standard

CAT#: PH301957

POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025)

Product Images

Coomassie blue staining of purified POLR2K protein (Cat# TP301957). The protein was produced from HEK293T cells transfected with POLR2K cDNA clone (Cat# RC201957) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201957
• Predicted MW: 7 kDa
• Protein Sequence:
  Sequence Link

  >RC201957 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005025
• RefSeq Size: 971
• RefSeq ORF: 174
• Synonyms: ABC10-alpha; hRPB7.0; hsRPB10a; RPABC4; RPB7.0; RPB10alpha; RPB12
• Locus ID: 5440
• UniProt ID: P53803, A0A024R9G0
• Cytogenetics: 8q22.2
• Summary: This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase