TPD52L1 (NM_001003396) Human Mass Spec Standard
CAT#: PH301816
TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201816 |
Predicted MW | 16.2 kDa |
Protein Sequence |
>RC201816 protein sequence
Red=Cloning site Green=Tags(s) MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK LGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA MRRK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001003396 |
RefSeq Size | 1327 |
RefSeq ORF | 432 |
Synonyms | D53; TPD53 |
Locus ID | 7164 |
UniProt ID | Q16890, Q15730 |
Cytogenetics | 6q22.31 |
Summary | This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed. [provided by RefSeq, Jan 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424123 | TPD52L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424123 | Transient overexpression lysate of tumor protein D52-like 1 (TPD52L1), transcript variant 3 |
USD 436.00 |
|
TP301816 | Recombinant protein of human tumor protein D52-like 1 (TPD52L1), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review