RAB7 (RAB7A) (NM_004637) Human Mass Spec Standard
CAT#: PH301776
RAB7A MS Standard C13 and N15-labeled recombinant protein (NP_004628)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201776 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC201776 protein sequence
Red=Cloning site Green=Tags(s) MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004628 |
RefSeq Size | 2240 |
RefSeq ORF | 621 |
Synonyms | CMT2B; PRO2706; RAB7 |
Locus ID | 7879 |
UniProt ID | P51149, A0A158RFU6 |
Cytogenetics | 3q21.3 |
Summary | RAB family members are small, RAS-related GTP-binding proteins that are important regulators of vesicular transport. Each RAB protein targets multiple proteins that act in exocytic / endocytic pathways. This gene encodes a RAB family member that regulates vesicle traffic in the late endosomes and also from late endosomes to lysosomes. This encoded protein is also involved in the cellular vacuolation of the VacA cytotoxin of Helicobacter pylori. Mutations at highly conserved amino acid residues in this gene have caused some forms of Charcot-Marie-Tooth (CMT) type 2 neuropathies. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417854 | RAB7A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417854 | Transient overexpression lysate of RAB7A, member RAS oncogene family (RAB7A) |
USD 436.00 |
|
TP301776 | Recombinant protein of human RAB7A, member RAS oncogene family (RAB7A), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review