C8orf40 (SMIM19) (NM_138436) Human Mass Spec Standard

CAT#: PH301439

C8orf40 MS Standard C13 and N15-labeled recombinant protein (NP_612445)

Product Images

Coomassie blue staining of purified SMIM19 protein (Cat# TP301439). The protein was produced from HEK293T cells transfected with SMIM19 cDNA clone (Cat# RC201439) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201439
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201439 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTEETLSEPNFYDTISKIRL
  RQQLEMYSISRKYDYQQPQNQADSVQLSLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612445
• RefSeq Size: 866
• RefSeq ORF: 300
• Synonyms: C8orf40
• Locus ID: 114926
• UniProt ID: Q96E16
• Cytogenetics: 8p11.21
• Protein Families: Transmembrane