SDHAF2 (NM_017841) Human Mass Spec Standard
CAT#: PH301437
SDHAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060311)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201437 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC201437 protein sequence
Red=Cloning site Green=Tags(s) MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARL LYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALL RDFAKNKNKEQRLRAPDLEYLFEKPR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060311 |
RefSeq Size | 1227 |
RefSeq ORF | 498 |
Synonyms | C11orf79; PGL2; SDH5 |
Locus ID | 54949 |
UniProt ID | Q9NX18 |
Cytogenetics | 11q12.2 |
Summary | This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma.[provided by RefSeq, Jul 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402625 | SDHAF2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402625 | Transient overexpression lysate of succinate dehydrogenase complex assembly factor 2 (SDHAF2) |
USD 436.00 |
|
TP301437 | Recombinant protein of human chromosome 11 open reading frame 79 (C11orf79), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review