OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SDHAF2 (NM_017841) Human Mass Spec Standard

Be the first to review this product
SKU
PH301437
SDHAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060311)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319947 Chicken Polyclonal SDHAF2 Antibody
100 ug
$640.00
LY402625 Transient overexpression lysate of succinate dehydrogenase complex assembly factor 2 (SDHAF2) (as WB positive control) 100 ug
$436.00

Other products for "SDHAF2 or NM_017841"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201437
Predicted MW 19.6 kDa
Protein Sequence
Protein Sequence
>RC201437 protein sequence
Red=Cloning site Green=Tags(s)

MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARL
LYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALL
RDFAKNKNKEQRLRAPDLEYLFEKPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060311
RefSeq Size 1227
RefSeq ORF 498
Synonyms C11orf79; PGL2; SDH5
Locus ID 54949
UniProt ID Q9NX18
Cytogenetics 11q12.2
Summary This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma.provided by RefSeq, Jul 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SDHAF2" proteins (3)
SKU Description Size Price
LC402625 Lyophilized SDHAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402625 Transient overexpression lysate of succinate dehydrogenase complex assembly factor 2 (SDHAF2) (as WB positive control) 100 ug
$436.00
TP301437 Recombinant protein of human chromosome 11 open reading frame 79 (C11orf79), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products