DHRS11 (NM_024308) Human Mass Spec Standard
CAT#: PH301307
DHRS11 MS Standard C13 and N15-labeled recombinant protein (NP_077284)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201307 |
Predicted MW | 28.3 kDa |
Protein Sequence |
>RC201307 protein sequence
Red=Cloning site Green=Tags(s) MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_077284 |
RefSeq Size | 1608 |
RefSeq ORF | 780 |
Synonyms | ARPG836; SDR24C1; spDHRS11 |
Locus ID | 79154 |
UniProt ID | Q6UWP2, A0A024R0T1 |
Cytogenetics | 17q12 |
Summary | Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta-hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411327 | DHRS11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411327 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 11 (DHRS11) |
USD 436.00 |
|
TP301307 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 11 (DHRS11), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review