p23 (PTGES3) (NM_006601) Human Mass Spec Standard
CAT#: PH301254
PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201254 |
Predicted MW | 18.7 kDa |
Protein Sequence |
>RC201254 protein sequence
Red=Cloning site Green=Tags(s) MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE VDGADDDSQDSDDEKMPDLE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006592 |
RefSeq Size | 2045 |
RefSeq ORF | 480 |
Synonyms | cPGES; P23; TEBP |
Locus ID | 10728 |
UniProt ID | Q15185, A0A024RB32 |
Cytogenetics | 12 |
Summary | This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401975 | PTGES3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401975 | Transient overexpression lysate of prostaglandin E synthase 3 (cytosolic) (PTGES3) |
USD 436.00 |
|
TP301254 | Recombinant protein of human prostaglandin E synthase 3 (cytosolic) (PTGES3), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review