p23 (PTGES3) (NM_006601) Human Recombinant Protein
CAT#: TP301254
Recombinant protein of human prostaglandin E synthase 3 (cytosolic) (PTGES3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201254 protein sequence
Red=Cloning site Green=Tags(s) MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE VDGADDDSQDSDDEKMPDLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006592 |
Locus ID | 10728 |
UniProt ID | Q15185, A0A024RB32 |
Cytogenetics | 12 |
Refseq Size | 2045 |
Refseq ORF | 480 |
Synonyms | cPGES; P23; TEBP |
Summary | This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401975 | PTGES3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401975 | Transient overexpression lysate of prostaglandin E synthase 3 (cytosolic) (PTGES3) |
USD 436.00 |
|
PH301254 | PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review