CDK2AP2 (NM_005851) Human Mass Spec Standard
CAT#: PH301178
CDK2AP2 MS Standard C13 and N15-labeled recombinant protein (NP_005842)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201178 |
Predicted MW | 13.1 kDa |
Protein Sequence |
>RC201178 protein sequence
Red=Cloning site Green=Tags(s) MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005842 |
RefSeq Size | 1499 |
RefSeq ORF | 378 |
Synonyms | DOC-1R; p14 |
Locus ID | 10263 |
UniProt ID | O75956, Q6IAV4 |
Cytogenetics | 11q13.2 |
Summary | This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417039 | CDK2AP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417039 | Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 2 (CDK2AP2) |
USD 436.00 |
|
TP301178 | Recombinant protein of human cyclin-dependent kinase 2 associated protein 2 (CDK2AP2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review