ATP5F1D (NM_001001975) Human Mass Spec Standard
CAT#: PH301157
ATP5D MS Standard C13 and N15-labeled recombinant protein (NP_001001975)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201157 |
Predicted MW | 17.5 kDa |
Protein Sequence |
>RC201157 protein sequence
Red=Cloning site Green=Tags(s) MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGIL AAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAE LVGTADEATRAEIQIRIEANEALVKALE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001001975 |
RefSeq Size | 709 |
RefSeq ORF | 504 |
Synonyms | ATP5D; MC5DN5 |
Locus ID | 513 |
UniProt ID | P30049 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419790 | ATP5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424304 | ATP5D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419790 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY424304 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
PH311715 | ATP5D MS Standard C13 and N15-labeled recombinant protein (NP_001678) |
USD 3,255.00 |
|
TP301157 | Purified recombinant protein of Homo sapiens ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
USD 867.00 |
|
TP311715 | Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review