CRALBP (RLBP1) (NM_000326) Human Mass Spec Standard

CAT#: PH301136

RLBP1 MS Standard C13 and N15-labeled recombinant protein (NP_000317)

Product Images

Coomassie blue staining of purified RLBP1 protein (Cat# TP301136). The protein was produced from HEK293T cells transfected with RLBP1 cDNA clone (Cat# RC201136) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201136
• Predicted MW: 36.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201136 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEAVRELQEMV
  QAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTI
  EAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQ
  QAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEI
  DENILPSDFGGTLPKYDGKAVAEQLFGPQAQAENTAF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000317
• RefSeq Size: 1752
• RefSeq ORF: 951
• Synonyms: CRALBP
• Locus ID: 6017
• UniProt ID: P12271
• Cytogenetics: 15q26.1
• Summary: The protein encoded by this gene is a 36-kD water-soluble protein which carries 11-cis-retinaldehyde or 11-cis-retinal as physiologic ligands. It may be a functional component of the visual cycle. Mutations of this gene have been associated with severe rod-cone dystrophy, Bothnia dystrophy (nonsyndromic autosomal recessive retinitis pigmentosa) and retinitis punctata albescens. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome