AP3S2 (NM_005829) Human Mass Spec Standard

CAT#: PH301104

AP3S2 MS Standard C13 and N15-labeled recombinant protein (NP_005820)

Product Images

Coomassie blue staining of purified AP3S2 protein (Cat# TP301104). The protein was produced from HEK293T cells transfected with AP3S2 cDNA clone (Cat# RC201104) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201104
• Predicted MW: 22 kDa
• Protein Sequence:
  Sequence Link

  >RC201104 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYAT
  LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQ
  IEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005820
• RefSeq Size: 5934
• RefSeq ORF: 579
• Synonyms: AP3S3; sigma3b
• Locus ID: 10239
• UniProt ID: P59780, A0A024RC62
• Cytogenetics: 15q26.1
• Summary: Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Lysosome