STIP1 (NM_006819) Human Mass Spec Standard
CAT#: PH301084
STIP1 MS Standard C13 and N15-labeled recombinant protein (NP_006810)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201084 |
Predicted MW | 62.6 kDa |
Protein Sequence |
>RC201084 protein sequence
Red=Cloning site Green=Tags(s) MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006810 |
RefSeq Size | 2219 |
RefSeq ORF | 1629 |
Synonyms | HEL-S-94n; HOP; IEF-SSP-3521; P60; STI1; STI1L |
Locus ID | 10963 |
UniProt ID | P31948, V9HW72 |
Cytogenetics | 11q13.1 |
Summary | STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Prion diseases |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416401 | STIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416401 | Transient overexpression lysate of stress-induced-phosphoprotein 1 (STIP1) |
USD 436.00 |
|
TP301084 | Recombinant protein of human stress-induced-phosphoprotein 1 (STIP1), 20 µg |
USD 867.00 |
|
TP710087 | Recombinant protein of human human stress-induced-phosphoprotein 1 (STIP1), full length, with N-terminal His tag, expressed in sf9 cells |
USD 515.00 |
|
TP710122 | Recombinant protein of human human stress-induced-phosphoprotein 1 (STIP1), full length, with C-terminal DDK tag, expressed in sf9 cells |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review