CDC42EP3 (NM_006449) Human Mass Spec Standard
CAT#: PH301069
CDC42EP3 MS Standard C13 and N15-labeled recombinant protein (NP_006440)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201069 |
Predicted MW | 27.7 kDa |
Protein Sequence |
>RC201069 protein sequence
Red=Cloning site Green=Tags(s) MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006440 |
RefSeq Size | 5715 |
RefSeq ORF | 762 |
Synonyms | BORG2; CEP3; UB1 |
Locus ID | 10602 |
UniProt ID | Q9UKI2 |
Cytogenetics | 2p22.2 |
Summary | This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416634 | CDC42EP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416634 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3) |
USD 436.00 |
|
TP301069 | Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review