COPZ1 (NM_016057) Human Mass Spec Standard

CAT#: PH301023

COPZ1 MS Standard C13 and N15-labeled recombinant protein (NP_057141)

Product Images

Coomassie blue staining of purified COPZ1 protein (Cat# TP301023). The protein was produced from HEK293T cells transfected with COPZ1 cDNA clone (Cat# RC201023) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201023
• Predicted MW: 20.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201023 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK
  SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ
  QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057141
• RefSeq Size: 1954
• RefSeq ORF: 531
• Synonyms: CGI-120; COPZ; HSPC181; zeta-COP; zeta1-COP
• Locus ID: 22818
• UniProt ID: P61923, A0A024RB72
• Cytogenetics: 12q13.13
• Summary: This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]