OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COPZ1 (NM_016057) Human Mass Spec Standard

Be the first to review this product
SKU
PH301023
COPZ1 MS Standard C13 and N15-labeled recombinant protein (NP_057141)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374999 COPZ1 Rabbit polyclonal Antibody
100 ul
$410.00
LY414222 Transient overexpression lysate of coatomer protein complex, subunit zeta 1 (COPZ1) (as WB positive control) 100 ug
$436.00

Other products for "COPZ1 or NM_016057"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201023
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC201023 protein sequence
Red=Cloning site Green=Tags(s)

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK
SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ
QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057141
RefSeq Size 1954
RefSeq ORF 531
Synonyms CGI-120; COPZ; HSPC181; zeta-COP; zeta1-COP
Locus ID 22818
UniProt ID P61923
Cytogenetics 12q13.13
Summary This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COPZ1" proteins (3)
SKU Description Size Price
LC414222 Lyophilized COPZ1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414222 Transient overexpression lysate of coatomer protein complex, subunit zeta 1 (COPZ1) (as WB positive control) 100 ug
$436.00
TP301023 Recombinant protein of human coatomer protein complex, subunit zeta 1 (COPZ1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products