COPZ1 (NM_016057) Human Tagged ORF Clone

CAT#: RC201023

COPZ1 (Myc-DDK-tagged)-Human coatomer protein complex, subunit zeta 1 (COPZ1)

  View "NM_016057" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name COPZ1 (NM_016057) Human Tagged ORF Clone
Symbol COPZ1
Synonyms CGI-120; COPZ; HSPC181; zeta-COP; zeta1-COP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201023 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCTGATTTTGGAACCTTCCCTGTATACTGTCAAAGCCATCCTGATTCTGGACAATGATGGAG
ATCGACTTTTTGCCAAGTACTATGACGACACCTACCCCAGTGTCAAGGAGCAAAAGGCCTTTGAGAAGAA
CATTTTCAACAAGACCCATCGGACTGACAGTGAAATTGCCCTCTTGGAAGGCCTGACAGTGGTATACAAA
AGCAGTATAGATCTCTATTTCTATGTGATTGGCAGCTCCTATGAAAATGAGCTGATGCTTATGGCTGTTC
TGAACTGTCTCTTCGACTCATTGAGCCAGATGCTGAGGAAAAATGTAGAAAAGCGAGCACTGCTGGAGAA
CATGGAGGGGCTGTTCTTGGCTGTGGATGAAATTGTAGATGGAGGGGTGATCCTAGAGAGTGATCCCCAG
CAGGTGGTACACCGGGTGGCATTAAGGGGTGAAGATGTCCCCCTTACGGAGCAGACCGTGTCTCAGGTGC
TGCAGTCAGCCAAAGAACAGATCAAGTGGTCACTCCTTCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201023 protein sequence
Red=Cloning site Green=Tags(s)

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK
SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ
QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016057
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016057.1, NM_016057.2, NP_057141
RefSeq Size 1954
RefSeq ORF 534
Locus ID 22818
Cytogenetics 12q13.13
Domains Clat_adaptor_s
MW 20.2 kDa
Gene Summary This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Other Versions

Other products for "COPZ1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit polyclonal anti-COPZ1 antibody
    • 100 ul

USD 335.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones