MSI2 (NM_138962) Human Mass Spec Standard
CAT#: PH301003
MSI2 MS Standard C13 and N15-labeled recombinant protein (NP_620412)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201003 |
Predicted MW | 35.2 kDa |
Protein Sequence |
>RC201003 protein sequence
Red=Cloning site Green=Tags(s) MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620412 |
RefSeq Size | 1581 |
RefSeq ORF | 984 |
Synonyms | MSI2H |
Locus ID | 124540 |
UniProt ID | Q96DH6 |
Cytogenetics | 17q22 |
Summary | This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells. [provided by RefSeq, Apr 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403371 | MSI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406896 | MSI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403371 | Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 1 |
USD 436.00 |
|
LY406896 | Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 2 |
USD 436.00 |
|
TP301003 | Recombinant protein of human musashi homolog 2 (Drosophila) (MSI2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review