ISG20L2 (NM_030980) Human Mass Spec Standard

CAT#: PH300946

ISG20L2 MS Standard C13 and N15-labeled recombinant protein (NP_112242)

Product Images

Coomassie blue staining of purified ISG20L2 protein (Cat# TP300946). The protein was produced from HEK293T cells transfected with ISG20L2 cDNA clone (Cat# RC200946) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200946
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200946 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT
  WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS
  SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV
  LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT
  RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP
  PTD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112242
• RefSeq Size: 2051
• RefSeq ORF: 1059
• Synonyms: FLJ12671
• Locus ID: 81875
• UniProt ID: Q9H9L3
• Cytogenetics: 1q23.1
• Summary: This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. [provided by RefSeq, Dec 2014]