SSU72 (NM_014188) Human Mass Spec Standard

CAT#: PH300900

SSU72 MS Standard C13 and N15-labeled recombinant protein (NP_054907)

Product Images

Coomassie blue staining of purified SSU72 protein (Cat# TP300900). The protein was produced from HEK293T cells transfected with SSU72 cDNA clone (Cat# RC200900) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200900
• Predicted MW: 22.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200900 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR
  KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD
  IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054907
• RefSeq Size: 1319
• RefSeq ORF: 582
• Synonyms: HSPC182; PNAS-120
• Locus ID: 29101
• UniProt ID: Q9NP77
• Cytogenetics: 1p36.33
• Summary: Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome