DPCD (NM_015448) Human Mass Spec Standard
CAT#: PH300890
DPCD MS Standard C13 and N15-labeled recombinant protein (NP_056263)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200890 |
Predicted MW | 23.2 kDa |
Protein Sequence |
>RC200890 protein sequence
Red=Cloning site Green=Tags(s) MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGD PAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKF SIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056263 |
RefSeq Size | 858 |
RefSeq ORF | 609 |
Locus ID | 25911 |
UniProt ID | Q9BVM2 |
Cytogenetics | 10q24.32 |
Summary | This gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary dyskinesia. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414547 | DPCD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414547 | Transient overexpression lysate of deleted in primary ciliary dyskinesia homolog (mouse) (DPCD) |
USD 436.00 |
|
TP300890 | Recombinant protein of human deleted in a mouse model of primary ciliary dyskinesia (RP11-529I10.4), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review