URM1 (NM_030914) Human Mass Spec Standard

CAT#: PH300854

URM1 MS Standard C13 and N15-labeled recombinant protein (NP_112176)

Product Images

Coomassie blue staining of purified URM1 protein (Cat# TP300854). The protein was produced from HEK293T cells transfected with URM1 cDNA clone (Cat# RC200854) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200854
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200854 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL
  INDADWELLGELDYQLQDQDSVLFISTLHGG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112176
• RefSeq Size: 2650
• RefSeq ORF: 303
• Synonyms: C9orf74
• Locus ID: 81605
• UniProt ID: Q9BTM9, A0A024R8C7
• Cytogenetics: 9q34.11
• Summary: Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.[UniProtKB/Swiss-Prot Function]