HSCB (NM_172002) Human Mass Spec Standard

CAT#: PH300843

HSCB MS Standard C13 and N15-labeled recombinant protein (NP_741999)

Product Images

Coomassie blue staining of purified HSCB protein (Cat# TP300843). The protein was produced from HEK293T cells transfected with HSCB cDNA clone (Cat# RC200843) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200843
• Predicted MW: 27.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200843 representing NM_172002
  Red=Cloning site Green=Tags(s)
  
  MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT
  RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY
  LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE
  AKEILTKMRYFSNIEEKIKLKKIPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_741999
• RefSeq Size: 1106
• RefSeq ORF: 705
• Synonyms: DNAJC20; HSC20; JAC1
• Locus ID: 150274
• UniProt ID: Q8IWL3, A0A384NYJ4
• Cytogenetics: 22q12.1
• Summary: This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]