DDA1 (NM_024050) Human Mass Spec Standard

CAT#: PH300826

DDA1 MS Standard C13 and N15-labeled recombinant protein (NP_076955)

Product Images

Coomassie blue staining of purified DDA1 protein (Cat# TP300826). The protein was produced from HEK293T cells transfected with DDA1 cDNA clone (Cat# RC200826) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200826
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200826 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK
  KRDQEQVELEGESSAPPRKVARTDSPDMHEDT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076955
• RefSeq Size: 4078
• RefSeq ORF: 306
• Synonyms: C19orf58; PCIA1
• Locus ID: 79016
• UniProt ID: Q9BW61, A0A024R7J7
• Cytogenetics: 19p13.11
• Summary: May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD-E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins.[UniProtKB/Swiss-Prot Function]