C3orf10 (BRK1) (NM_018462) Human Mass Spec Standard

CAT#: PH300804

C3orf10 MS Standard C13 and N15-labeled recombinant protein (NP_060932)

Product Images

Coomassie blue staining of purified BRK1 protein (Cat# TP300804). The protein was produced from HEK293T cells transfected with BRK1 cDNA clone (Cat# RC200804) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200804
• Predicted MW: 8.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200804 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
  GETLT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060932
• RefSeq Size: 1197
• RefSeq ORF: 225
• Synonyms: C3orf10; hHBrk1; HSPC300; MDS027
• Locus ID: 55845
• UniProt ID: Q8WUW1
• Cytogenetics: 3p25.3
• Summary: Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Regulation of actin cytoskeleton