PRPS1 (NM_002764) Human Mass Spec Standard
CAT#: PH300698
PRPS1 MS Standard C13 and N15-labeled recombinant protein (NP_002755)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200698 |
Predicted MW | 34.8 kDa |
Protein Sequence |
>RC200698 protein sequence
Red=Cloning site Green=Tags(s) MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMEL LIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDI PVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGD VKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDK MKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002755 |
RefSeq Size | 2156 |
RefSeq ORF | 954 |
Synonyms | ARTS; CMTX5; DFN2; DFNX1; PPRibP; PRS-I; PRSI |
Locus ID | 5631 |
UniProt ID | P60891 |
Cytogenetics | Xq22.3 |
Summary | This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pentose phosphate pathway, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400979 | PRPS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400979 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 1 (PRPS1) |
USD 436.00 |
|
TP300698 | Recombinant protein of human phosphoribosyl pyrophosphate synthetase 1 (PRPS1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review