ESE1 (ELF3) (NM_004433) Human Mass Spec Standard
CAT#: PH300631
ELF3 MS Standard C13 and N15-labeled recombinant protein (NP_004424)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200631 |
Predicted MW | 41.5 kDa |
Protein Sequence |
>RC200631 protein sequence
Red=Cloning site Green=Tags(s) MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL VYKFGKNSSGWKEEEVLQSRN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004424 |
RefSeq Size | 3149 |
RefSeq ORF | 1113 |
Synonyms | EPR-1; ERT; ESE-1; ESX |
Locus ID | 1999 |
UniProt ID | P78545, A0A024R974 |
Cytogenetics | 1q32.1 |
Summary | Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401407 | ELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426477 | ELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401407 | Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 |
USD 436.00 |
|
LY426477 | Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 2 |
USD 436.00 |
|
TP300631 | Recombinant protein of human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review