Calumenin (CALU) (NM_001219) Human Mass Spec Standard
CAT#: PH300589
CALU MS Standard C13 and N15-labeled recombinant protein (NP_001210)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200589 |
Predicted MW | 37.1 kDa |
Protein Sequence |
>RC200589 protein sequence
Red=Cloning site Green=Tags(s) MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001210 |
RefSeq Size | 5366 |
RefSeq ORF | 945 |
Locus ID | 813 |
UniProt ID | O43852, Q6IAW5, B3KQF5, D6QS48 |
Cytogenetics | 7q32.1 |
Summary | The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400488 | CALU HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427231 | CALU HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400488 | Transient overexpression lysate of calumenin (CALU), transcript variant 1 |
USD 436.00 |
|
LY427231 | Transient overexpression lysate of calumenin (CALU), transcript variant 2 |
USD 436.00 |
|
TP300589 | Recombinant protein of human calumenin (CALU), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720752 | Purified recombinant protein of Human calumenin (CALU), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review