RFC4 (NM_002916) Human Mass Spec Standard
CAT#: PH300426
RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_002907)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200426 |
Predicted MW | 39.7 kDa |
Protein Sequence |
>RC200426 protein sequence
Red=Cloning site Green=Tags(s) MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002907 |
RefSeq Size | 1427 |
RefSeq ORF | 1089 |
Synonyms | A1; RFC37 |
Locus ID | 5984 |
UniProt ID | P35249 |
Cytogenetics | 3q27.3 |
Summary | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405706 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419019 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405706 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2 |
USD 436.00 |
|
LY419019 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1 |
USD 436.00 |
|
PH311392 | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_853551) |
USD 3,255.00 |
|
TP300426 | Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1, 20 µg |
USD 867.00 |
|
TP311392 | Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review