Chemerin (RARRES2) (NM_002889) Human Mass Spec Standard
CAT#: PH300383
RARRES2 MS Standard C13 and N15-labeled recombinant protein (NP_002880)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200383 |
Predicted MW | 18.6 kDa |
Protein Sequence |
>RC200383 protein sequence
Red=Cloning site Green=Tags(s) MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR AGEDPHSFYFPGQFAFSKALPRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002880 |
RefSeq Size | 767 |
RefSeq ORF | 489 |
Synonyms | HP10433; TIG2 |
Locus ID | 5919 |
UniProt ID | Q99969, A0A090N7U9 |
Cytogenetics | 7q36.1 |
Summary | This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401013 | RARRES2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401013 | Transient overexpression lysate of retinoic acid receptor responder (tazarotene induced) 2 (RARRES2) |
USD 436.00 |
|
TP300383 | Recombinant protein of human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review