Syntaxin 4 (STX4) (NM_004604) Human Mass Spec Standard

CAT#: PH300347

STX4 MS Standard C13 and N15-labeled recombinant protein (NP_004595)

Product Images

Coomassie blue staining of purified STX4 protein (Cat# TP300347). The protein was produced from HEK293T cells transfected with STX4 cDNA clone (Cat# RC200347) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200347
• Predicted MW: 34.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200347 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL
  ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK
  CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI
  QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV
  SITVVLLAVIIGVTVVG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004595
• RefSeq Size: 1494
• RefSeq ORF: 891
• Synonyms: p35-2; STX4A
• Locus ID: 6810
• UniProt ID: Q12846
• Cytogenetics: 16p11.2
• Summary: Plasma membrane t-SNARE that mediates docking of transport vesicles. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes (By similarity). May also play a role in docking of synaptic vesicles at presynaptic active zones.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport