NAT9 Rabbit Polyclonal Antibody

CAT#: TA346778

Rabbit Polyclonal Anti-NAT9 Antibody

Product Images

Host: Rabbit; Target Name: NAT9; Sample Tissue: Fetal Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NAT9 antibody is: synthetic peptide directed towards the C-terminal region of Human NAT9. Synthetic peptide located within the following region: KLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: N-acetyltransferase 9 (putative)
• Database Link:
  NP_056469
  Entrez Gene 26151 Human
  UniProt ID Q9BTE0
• Background: The function of this protein remains unknown.
• Synonyms: EBSP; hNATL
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 79%