ACCSL Rabbit Polyclonal Antibody

CAT#: TA346692

Rabbit Polyclonal Anti-ACCSL Antibody

Product Images

WB Suggested Anti-ACCSL Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACCSL antibody: synthetic peptide directed towards the N terminal of human LOC390110. Synthetic peptide located within the following region: MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: 1-aminocyclopropane-1-carboxylate synthase (inactive)-like
• Database Link:
  NP_001027025
  Entrez Gene 390110 Human
  UniProt ID Q4AC99
• Background: The exact function of LOC390110 remains unknown.
• Synonyms: 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like
• Note: Immunogen Sequence Homology: Human: 100%