TRUB2 Rabbit Polyclonal Antibody

CAT#: TA346619

Rabbit Polyclonal Anti-TRUB2 Antibody

Product Images

WB Suggested Anti-TRUB2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRUB2 antibody: synthetic peptide directed towards the N terminal of human TRUB2. Synthetic peptide located within the following region: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: TruB pseudouridine synthase family member 2
• Database Link:
  NP_056494
  Entrez Gene 26995 Human
  UniProt ID O95900
• Background: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AK001956.1, AF131848.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END##
• Synonyms: CLONE24922
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79%