Tropomyosin 2 (TPM2) Rabbit Polyclonal Antibody

CAT#: TA346576

Rabbit Polyclonal Anti-TPM2 Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: HepG2

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2. Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: tropomyosin 2 (beta)
• Database Link:
  NP_003280
  Entrez Gene 7169 Human
  UniProt ID P07951
• Background: This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
• Synonyms: AMCD1; DA1; DA2B; HEL-S-273; NEM4; TMSB
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Pig: 85%; Horse: 85%; Sheep: 85%; Guinea pig: 79%

Reference Data

• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)