Galectin 13 (LGALS13) Rabbit Polyclonal Antibody

CAT#: TA346471

Rabbit Polyclonal Anti-LGALS13 Antibody

Product Images

WB Suggested Anti-LGALS13 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LGALS13 antibody: synthetic peptide directed towards the N terminal of human LGALS13. Synthetic peptide located within the following region: AFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: galectin 13
• Database Link:
  NP_037400
  Entrez Gene 29124 Human
  UniProt ID Q9UHV8
• Background: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family.
• Synonyms: GAL13; PLAC8; PP13
• Note: Immunogen Sequence Homology: Human: 100%