SARDH Rabbit Polyclonal Antibody

CAT#: TA346452

Rabbit Polyclonal Anti-SARDH Antibody

Product Images

WB Suggested Anti-SARDH Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate; SARDH is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-SARDH Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SARDH antibody: synthetic peptide directed towards the middle region of human SARDH. Synthetic peptide located within the following region: DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: sarcosine dehydrogenase
• Database Link:
  NP_001128179
  Entrez Gene 1757 Human
  UniProt ID Q9UL12
• Background: The function remains known.
• Synonyms: BPR-2; DMGDHL1; SAR; SARD; SDH
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Glycine, serine and threonine metabolism, Metabolic pathways