Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody

CAT#: TA346442

Rabbit Polyclonal Anti-PSG1 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human pregnancy specific beta-1-glycoprotein 1 (PSG1), 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 1 (PSG1), transcript variant 3
    • 100 ug

USD 436.00

Other products for "Pregnancy Specific Glycoprotein 1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the N terminal of human PSG1. Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name pregnancy specific beta-1-glycoprotein 1
Background The function remains unknown.
Synonyms 2; B1G1; CD66f; D; DHFRP2; FL-NCA-1; PBG1; PS-beta-C; PS-beta-G-1; PSBG-1; PSBG1; PSG95; PSGGA
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.