acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody

CAT#: TA346440

Rabbit Polyclonal Anti-ACOT2 Antibody

Product Images

WB Suggested Anti-ACOT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: ACOT2; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACOT2 antibody: synthetic peptide directed towards the middle region of human ACOT2. Synthetic peptide located within the following region: SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: acyl-CoA thioesterase 2
• Database Link:
  NP_006812
  Entrez Gene 10965 Human
  UniProt ID P49753
• Background: Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079
• Synonyms: CTE-IA; CTE1A; MTE1; PTE2; PTE2A; ZAP128
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 92%; Mouse: 92%; Rabbit: 92%

Reference Data

• Protein Pathways: Biosynthesis of unsaturated fatty acids