CYB561 Rabbit Polyclonal Antibody

CAT#: TA346253

Reviews ()
Write a review

Rabbit Polyclonal Anti-CYB561 Antibody

Get 29% off any Over-Expression Cell Lysate, a validated WB control, with any Ab purchase. Use code “OEL29“. View details.

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CYB561 antibody: synthetic peptide directed towards the middle region of human CYB561. Synthetic peptide located within the following region: NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name cytochrome b561
Background CYB561 is a senescene-associated protein in normal human oral keratinocytes. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms CYB561A1; FRRS2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%
Reference Data
Protein Families Transmembrane
Other products for "CYB561"
Frequently bought together (2)
Transient overexpression lysate of cytochrome b-561 (CYB561), transcript variant 2
    • 100 ug

USD 360.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies