Surfactant protein D (SFTPD) Rabbit Polyclonal Antibody

CAT#: TA346096

Rabbit Polyclonal Anti-SFTPD Antibody

Product Images

WB Suggested Anti-SFTPD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFTPD antibody: synthetic peptide directed towards the middle region of human SFTPD. Synthetic peptide located within the following region: PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: surfactant protein D
• Database Link:
  NP_003010
  Entrez Gene 6441 Human
  UniProt ID P35247
• Background: SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.
• Synonyms: COLEC7; PSP-D; SFTP4; SP-D
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein