WDR4 Rabbit Polyclonal Antibody

CAT#: TA346004

Rabbit Polyclonal Anti-WDR4 Antibody

Product Images

WB Suggested Anti-WDR4 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-WDR4 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR4 antibody: synthetic peptide directed towards the C terminal of human WDR4. Synthetic peptide located within the following region: AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: WD repeat domain 4
• Database Link:
  NP_387510
  Entrez Gene 10785 Human
  UniProt ID P57081
• Background: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: TRM82; TRMT82
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Pig: 90%; Mouse: 87%; Rabbit: 83%; Rat: 75%; Yeast: 75%