SNURPORTIN1 (SNUPN) Rabbit Polyclonal Antibody

CAT#: TA345926

Rabbit Polyclonal Anti-SNUPN Antibody

Product Images

WB Suggested Anti-SNUPN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNUPN antibody: synthetic peptide directed towards the middle region of human SNUPN. Synthetic peptide located within the following region: GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: snurportin 1
• Database Link:
  NP_005692
  Entrez Gene 10073 Human
  UniProt ID O95149
• Background: The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. The protein encoded by this gene interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene.
• Synonyms: KPNBL; RNUT1; Snurportin1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome