ZRSR2 Rabbit Polyclonal Antibody

CAT#: TA345909

Rabbit Polyclonal Anti-ZRSR2 Antibody

Product Images

WB Suggested Anti-ZRSR2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZRSR2 antibody: synthetic peptide directed towards the N terminal of human ZRSR2. Synthetic peptide located within the following region: LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2
• Database Link:
  NP_005080
  Entrez Gene 8233 Human
  UniProt ID Q15696
• Background: ZRSR2 is an essential splicing factor. The protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceoso
• Synonyms: U2AF1-RS2; U2AF1L2; U2AF1RS2; URP
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 85%; Yeast: 83%