ZNF671 Rabbit Polyclonal Antibody

CAT#: TA345802

Rabbit Polyclonal Anti-OAS1 Antibody

Product Images

WB Suggested Anti-OAS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Stomach

• 

  Immunohistochemistry with Small intestine tissue at an antibody concentration of 5 ug/ml using anti-OAS1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OAS1 antibody: synthetic peptide directed towards the N terminal of human OAS1. Synthetic peptide located within the following region: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: zinc finger protein 671
• Database Link:
  NP_079109
  Entrez Gene 79891 Human
  UniProt ID Q8TAW3
• Background: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactio
• Synonyms: FLJ23506
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Mouse: 86%; Bovine: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors