PHOSPHO2 Rabbit Polyclonal Antibody

CAT#: TA345718

Rabbit Polyclonal Anti-PHOSPHO2 Antibody

Product Images

WB Suggested Anti-PHOSPHO2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHOSPHO2 antibody: synthetic peptide directed towards the N terminal of human PHOSPHO2. Synthetic peptide located within the following region: MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: phosphatase, orphan 2
• Database Link:
  NP_001008489
  Entrez Gene 493911 Human
  UniProt ID Q8TCD6
• Background: PHOSPHO2 is a phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). PHOSPHO2 also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.
• Synonyms: MGC22679; MGC111048
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 79%; Mouse: 79%; Dog: 77%; Bovine: 77%