HMGB4 Rabbit Polyclonal Antibody

CAT#: TA345519

Rabbit Polyclonal Anti-HMGB4 Antibody

Product Images

WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the C terminal of human HMGB4. Synthetic peptide located within the following region: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: high mobility group box 4
• Database Link:
  NP_660206
  Entrez Gene 127540 Human
  UniProt ID Q8WW32
• Background: HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.
• Synonyms: dJ1007G16.5
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors