Ceramide synthase 2 (CERS2) Rabbit Polyclonal Antibody

CAT#: TA345355

Rabbit Polyclonal Anti-LASS2 Antibody

Product Images

WB Suggested Anti-LASS2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: ceramide synthase 2
• Database Link:
  NP_859530
  Entrez Gene 29956 Human
  UniProt ID Q96G23
• Background: LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth.
• Synonyms: L3; LASS2; SP260; TMSG1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors, Transmembrane