SLMO2 (PRELID3B) Rabbit Polyclonal Antibody

CAT#: TA345077

Rabbit Polyclonal Anti-SLMO2 Antibody - N-terminal region

Product Images

WB Suggested Anti-SLMO2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLMO2 antibody: synthetic peptide directed towards the N terminal of human SLMO2. Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: PRELI domain containing 3B
• Database Link:
  NP_057129
  Entrez Gene 51012 Human
  UniProt ID Q9Y3B1
• Background: The function of this protein remains unknown.
• Synonyms: C20orf45; dJ543J19.5; SLMO2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%